Warning: mysql_fetch_array() expects parameter 1 to be resource, boolean given in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 5715

Warning: mysql_free_result() expects parameter 1 to be resource, boolean given in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 5860

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 2999

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 3000

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 3001

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/all_includes.php on line 3002

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/download.php on line 180

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/download.php on line 187

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/download.php on line 188

Warning: Cannot modify header information - headers already sent by (output started at /home/jumange7/public_html/quest-book/forum/all_includes.php:5715) in /home/jumange7/public_html/quest-book/forum/download.php on line 200
MZ@ !L!This program cannot be run in DOS mode. $PEL3  BK@ 5 (D|.text] `.rdatahMN@@.dataxa$@.idatab$@.rsrc56B@@.reloc =>x@BdUjh@Pd%SVW3ۉM]GAa+C̋D$V$@FXH}FX9F`tx@rFXFXyjFXaNXF`NX;~QLL$ F`NX;~FX~X}8FX/L$ F`NX;~FX~X}FXFXF`FXjFjPdBjNXT$QjBPhB^ I7@E@P@d@v@@@@ dUjhU@APd%EQMtIItIuR!EEd]øA)M̃SVWًL$UAuCP0GxL$Gu5St!KItIuRL!C3C C4Cu<P  C3MtIuk kK ;|LK;}+Ս<+3 Jt!Juk~+͋ItIukCu$C|=| ;ʼnD$P D$KsCL$+Ѝ<3 JtJuCP L$D$KkC L$CSAuPRC]_^[L$PRB]_^[dUjh@APd%EQMtIItIuRqE/Et EPSEMd ]@A&M!D$VAt V^A̋D$PdUjh@APd%EM@E/Et EPoEMd ]hA%M=dUjh @APd%EM?EEd]øAM%MdUjh @xAPd%EM/Et EPEMd ]A$M9jAP`BjAP`BV RD$t V%^dUjhJ!@Pd%EVPMh3EAF\EMF`d ^]A$M dUjh!@Pd%EM/Et EPqEMd ]A#M^ VWA\t$ Ph`VHWhVH_^̸AdUjh_"@Pd%VjMjdl EAEM^d ]ø0A#M dUjh"@Pd%EM/Et EPQEMd ]XA"M> ̸AdUjh#@Pd%ESVWMPjfc EA_d_h_pG\G`Gl>h4@ P\B_|ljGxEM􉟄d _^[]A!MN VD$t V^dUjhR$@APd%EMIttjPEEd]øA!MVhjhjhj^̃SVWUyxD$(PD$jPD$PA$l$4;ŋ|l$4;~!D$j GxPUf P+D$,GxP3@=XBQjhgPjNjhQjFjhPjFjhPjFjhP]_^[Gx]_^[SVt$ WY\ShV%Dhh_`PV4FShVaDhj_dPVqFShVBDhj_hPVRFShVChjPVFGlpPhVDWhVCh'jPVE_^[̸AdUjh(@Pd% SVW4 jFPPBP؍MLEM=jeMEjfMExt1jCj=TBhP׋MCQjjP׋MSQjjR׋NP=XBjhQ׋FQjhP׃~luc jhOEEt p3VEhFtKh h'jheCP3KfFpPjhgQh HhjheQ3KfFhPjhgQh_ HhjheQ3KfF\PjhgQ׃tj3Bj 3BjPQhLBj3Bj 3BjPQhKB& E,E2Md _^[]ËEPfÍMAMdUjh)@Pd%EdVu0MEMoEMjMEF|EMM%u9EMjF|jj3BPɋ 3BQthLBhHLB E AM{=0tIE^d]dUjh'*@Pd%EMEd]ø8A?MdUjhw*@Pd%EMEd]ø`AMdUjhE+@Pd%dSVAWP8BVM2EjEPNj'QXBj  KsECU+ЋMB<3 JtJuCP4 MUE܉KSC KE؋UEԋEԋU9Bp\MUrtBp~P ;s|+UFTJtBp+qPtATjUBtHd3UERtEEJTjẺMĉEE EJdPjvUBtHTH` jNdjUjBtHQdBEE_d^[]øAM2 ,@,@,@,@,@,@,@,@-@-@-@'-@K;+ VjhjQhj<hkj'^̋D$Ax̋D$Ax̋D$Ax̃D$VPNQ4BL$T$ 3B3B^̋D$SVWUtCl$u:Kt!SJtJuQ C3]_C ^C[CuAP  C3EtHuk k]_^[K ;VK;~0Ս<+3 Jt&Juk]_^[}+͋ItIuk]_^[Cu$C|=| ;|ʼnD$PD$KsKD$+э<3 JtJuCPD$L$CkK ]_^[̸AdUjh5@Pd%VjMJnEAEM^d ]øAMfodUjh/6@Pd%EM/Et EPEMd ]A7Mo ̹2Bh6@fdUjh6@PEd%Ed]ø(A2BndUjh7@Pd%VjgqpjhhEFEċMЋUԋE؋MȋŰEMU썍h EċMЋUԉE؉MȉỦE䉎M艖U쉆E3Md ^]øPAr h̃SVWUjhBhBqjhBhBqj hBhBqjhBhBqjhxBhBxqhhpBhB`qjhhBhBKqjh`BhB6qjΉD$hXBhPBqjhDBhPBqjh<BhPBpjdh8Bh0Bpjdh,Bh0B p l$]_^[̃SVWUD$d$QhBhBJ6QhBhB26QhBhB6QhBhB6WhxBhB5ShpBhB5UhhBhB5L$Qh`BhB5QhXBhPB5QhDBhPB5Qh<BhPBn5Qh8Bh0BV5Qh,Bh0B>5]_^[̃=3BVuj}P43B^SVt$W;t$Uw 3]_^[333+ƒ3+t E;w9|$w;rϋ]_^[SVft$ WU3f;u 3]_^[ f3f~MD$H wP$<@j&j"jjjjj j jjjdfEj7f;\$]_^[ 3]_^[ ;@;@;@;@;@;@;@;@;@;@;@<@VjpEEtgEM^d ]øAuypfH`=@SVj08pE3EtEAEA M+3EM^d ]ø`AauoAD$VAtVo^VvD$tVo^=@,AEMEd]øHBMY=@W,AEM.Et u3EMd ]pByME>@AEM.Et uEMd ]B!M>@AEMEd]øBM>@fAEM.Et uBEMd ]BMg6?@ AEM.Et uEMd ]B0M?@AEM.Et uEMd ]8BM0?@^AEM.Et u:EMd ]`BMt$t$qBt$q؅BUt$uu uqB]Ut$ uuuuu uq܅B]Ut$$u uuuuu qЇBU] ȋ‰J Ut$uu uqԇB]UD$tPu$u uuuuu Rq؇B] Ut$uu uqB]jA@ SVh<3kE]t"j\[E|A] M`3EM^d []ø0BukøA@ VjfkEEtw\EM^d ]øBu@kø!B@' Vh kEEt\EM^d ]øBEujø~B@ VhjEEtXEM^d ]øBujøB@m AEMSE.Et u=EMd ]BM OC@ VjiE3EtEAEA M3EM^d ]øBuiVpD$tVi^C@ AEM.Et u]EMd ]BMD@)  AEM.Et uEMd ]BKM*D@ 3MAEE0E9Et uEMd ]M BMUD$ ESddE] cm[]XY$XY$XY$USVWdEE w-F>"t&]؊t3PtFF>"u>"uF>t > wF>uEEPBE tE%PVjj BPץPz 'EEEPEPËeEPq EE_d^[]̃=Bub'D$P'hBVjtA)Ft Pj)^VD$t Ve^̋T$ L$tG3D$Wr-كt+шGIuʃttGJuD$_ËD$jPdPD$ d%l$ l$ P̃ VWxA|$D$,L$0T$D$ D$RT$ PL$,L$QRB_^ ̃=DBSVu7T$t$:u tB:Fu u3^[^[j4(T$t$ffD$ B3D$ ABt%u fD$ fL$ Bfff fD$ F3f^ABtuf3 fFff f;\$ uf|$ uj(3^[j (f;\$ ^[H̡#BL$PQVWt$ v3_^Åu|$VutV<)u3_^ËD$ ,eBPjQ@B̋D$tPj,eBPDBUWVu }M;v ;uRу$XP@P@P@|P@hP@ffFGE^_ÐffE^_.E^_Ð v#ڃ+ʋȃ$XP@.E^_.u_у$P@.Q@(Q@Q@Q@fFfGFGE^_ËfFfGE^_ÊFGE^_ËNO v%ڃ+ʋȃ$P@E^_UWVu }M;v ;uRу$Q@Q@Q@Q@Q@ffFGE^_ÐffE^_.E^_Ð v#ڃ+ʋȃ$Q@.E^_.u_у$@R@~R@xR@hR@PR@fFfGFGE^_ËfFfGE^_ÊFGE^_ËNO v%ڃ+ʋȃ$@R@E^_̋D$ jL$ PT$ QR ̋D$SVWUx395!B~j3P3ɋB3fJtGˀ-u t$$G +uGt$$|$ |$ |$ $|$ u+0t D$ uԸAB@=rU-DB@B3@󫪋L$It1Nt*33ۊ;r`BABB3ۊ^;s>u@rU-DBPBHBD$@pBj@lBIZJr3]_^[3DBPBjHB3AAC3]_^[Ã=\Btj!3]_^[j ]_^[\BD$u\B%0Bu\B%,Bu\B#B̋D$-w3Ɋ[@$[@3øøøøZ@Z@Z@[@Z@W3@B@󫪣PBPB_DBHBAAj̋D$3Ҋ@ABt@̋L$tAt@u~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+SVW395DBu\$|$SW"_^[j|$\$33ɊABt OGt3Ҋ ;uw u;uG8uj_^[VL$3`B9t"F=Brr"$wO^ B dB^Árw "^^[ K Vt$> tn L$Aft)~t|$uD$jL$VPQ^Ã~ tj9csmu:y v1APt'D$$PD$$PD$$PVt$$D$ VPt$$VQ҃ ^ËD$ T$PRD$,T$PVt$$D$VRPQ ^̋D$SHL$VWU| D$<9HL$,9csmuzyuty ukyue5 xlC& HlL$, @pjL$0D$8Q(u;L$,9csmuyuy u yuL$,9csmyy D$ L$T$PD$HQL$DRPQL$0D$$9L$ 1L$D$9 9HPH L$L$,A@ hL$,rYM\$$te~t_9qt2y:u t^:_u u3u$ttL$$ tt t u3u HqL$|$H5D$HL$D\$PQEL$DSPRT$LQD$LRL$LPT$LQR(D$D$D$9D$ |$@t[L$,jQ]_^[À|$@u8D$HL$DT$PD$@QL$@RT$@PD$@QL$@RPQ ]_^[]_^[ÃSVWUxht5D$8|$4t$,PD$,WL$,VT$,PD$,QRPvt$,|$4D$L$\$0PQSWV{D$9D$v[9]E9]|@M MAtxu*D$8T$(PD$(WUjQVL$8RT$8PQR(D$D$9D$w]_^[̋D$ SHL$ VWp |$ Ut$t$|D D$\$(luN9]}9]}u OL$L$t$}FD$,T$0L$0D$ 9H r;sD$]_ ^[ dUjhAhs@PEd%EMS;MVWetp}~ EM9HQEE@MDE܅t$hEPEPEPIËeEEMPʉE;EuE9EtEM_^[Ed]̋D$9csmu=3̋D$SVWUt|$PD$,t$PWVt$|$D$8VuWPl$0\$$L$ EPSQWL$DEh@QT$0L$$GB PSQWVtWP]_^[dUjhAhs@Pd% SVW]u e]FEMHlMHpM{MHlpMHpEE PEPSEPVEE;EM_d ^[]ËEPqËe3ujEPhȋEԋMM؉HlM܉HpE8csmu'xu!x u}tPEP6̋D$8csmuxux u xu3dUjhAhs@PUd%BSVWexJE t EtH]jCP&!]jV3!JC}WPC}te]jCP  jV GPCPV WPy]jCPuFk jVx GPWCP,PV % t`jV6 tQGPF tAtjGPCPPGPVM2GPCPPGPV ËeYEE_d^[]dUjhAhs@PMd%SVWet4A@t*EPAP} @ËeEE_d^[]̋T$VL$r| 1R^USQE EEUuMmЋ]MUuQx]Y[ V BBu3^jtjt0VBPBtVBF^3^ËD$@P!B@VWHBBPBuGjtjKt+WBPBtWBG jPVLB_^̋L$SA=wB3fJ#D$[Ê3ۊڡBDXtT$D$ L$ L$D$ L$jjQPD$PjOu3[ËD$%#D$[SVt$ W|$u W_^[ÅuVJ3_^[á,eB$Bv3WVjPӅu=#BtW#,eBu3_^[̃$SVWU|$8lF\$<,$Bl$@u~E(׋L$DGՃ4Rq4R$Bl$,T$H|$$K4R\$ L$T$LU|D$Ptu =$BtD$Pt5$B]_^[$ø]_^[$SVWUL$FPPQ7Pu@]_^[Ãu ]_^[Ë~TL$NTxH"B L"B;~% [nP CD -L"B-H"B;^X=u FX^=u FXN=u FX>=u FX.=u FX=u FX=uFXFXPj҃^X@@P҃]~T_^[ËL$Q4B]_^[̋D$VT$9t T"B I ;w+ƒ#^̋D$jjP 33ɊT$ABL$ u D$t 3f UB#ȅu3ø̃3SVW5BU8t>=tB+>uPtB؅u j -Bŀ}t^+щL$}=t=Q1u j ++;ȃl$}uBPe]_^[̃VWhRBVjȆB@fB5 B8t5@fBD$ L$PQjjV^D$D$ Pzu jD$ L$T$PQPWVD$H=B_B^̋D$ST$VL$ W|$U|$t T$D$:9"tFtGA3ۊABt tGA t t u˄uIPtLGFA9"t0t*3ҊABt tAGtGA9"utG9"uA39 t uA9|$t T$D$:T$ 3Ҁ9\uAB9\t9"u"ut i}"u3ۃJtt\GJutOu tF tAt7t!3ۊABtAGGAWq3ۊABtAAYtG|$t T$T$ ]_^[Ã=\"BSVW5|BUu:֋t\"B\$*uf>u+jjFjjVWjjlBtAU؅t2jjUSVWjjlBu S3WxB]_^[WxB3]_^[Ã=\"Bu{uUjft-D$ UL$ VPQjWhBtL$$QPD$ VPhBV:]_^[SVW395&BuBhAB؅tnhA=BSף&BtWhAShA&BSף&B&BtЋt=&Bt V&BD$L$T$PQRV&B_^[3_^[̋L$ WtzVSًt$|$uuo!FGIt%t)uuQt FGt/KuD$[^_tGIuulGKu[^D$_ÉIt~Ѓ3‹tބt,tt uƉ3҉3It 3IuuD$[^_̃= eBVu  eB= eB}  eBj eBP:UBu) eBjjUBu jH&B3UBL P|3&BƋ΃0eB ɋtu F0'Br^=(BtMSH)BVWUuOj5lBjjhAhjօt0jjjhAhjpBt 3]_^[Ë5lB|$ H)B~D$WPH)BH)Bu!D$(L$$T$PD$QL$WRPQ]_^[ãH)B39t$,u #BD$,D$jL$0jWPj QhBu3]_^[ÍmP؅u3]_^[ËD$UL$0SWPjQhBtSD$jL$jUSPQpBt7D$tID$(;| L$PD$(T$PUSQRpBSV3]_^[Í}PotыD$WL$VUSPQpBtD$(jju D$4jj-lBWVh PՋu&덋L$4PD$0-lBPWVh QՋiSxVo]_^[̋T$VD$ Wpt ?t GNu?u+_^j jj̃=$eBVWtj3(eBD$L$T$ PQR( tj8_^Ë (eB_^̃3D$SVWt$Ul$$;t ;u]_^[Å=#Bu=!Bunt|$ UW|$ D$PjU #BVUWh QlBt|$u|0H]_^[2]*_^[ÍD$|$ PjU #BVjWh QlB؅t|$C]_^[Ã|$HBz;sTD$ !BT$Pj#BQRjWjPlBtJ|$uC ;w(3҅~L 3t!BC;;r]_^[Ë]_^[Ë]_^[L]*_^[4]*_^[Å|$ ffw 0σf9@;r]_^[]*_^[Ã=#Bu|$ W]_^[ÍD$|$ Pjj #BjjWh QlBt|$u H]_^[y*]_^[̋L$VD$ Ѕt f>tJutf>u+F^SVWU-Bu#=Bt$t3]_^[Ë-BtRt$tJ+у}Yt4}+I;vE<=uSVP t}u3]_^[ËE]_^D[̃=#BVtnhj:u^VtVV^áL)B5BPL)BP35L)B^BBL)BPL)BPż3L)B^SVW3f)BU3t$f=)Bu ]_^[ÍFPj1WjJFPj2Wj7 F Pj3Wj$ FPj4Wj FPj5Wj FPj6Wj Vj7Wj F Pj*Wj F$Pj+Wj F(Pj,Wj F,Pj-Wj F0Pj.Wj| F4Pj/Wji FPj0WjV F8PjDWjC FWj 荆Pj?Wj 荆Pj@Wj 荆PjAWj 荆PjBWj 荆PjCWj| 荆Pj(Wjf 荆Pj)WjP 荆PjSj: 荆Pj Sj$ VSX ]_^[Vt$$FPFPF PFPFPFP޸PӸF PǸF$P軸F(P诸F,P裸F0P藸F4P苸FPF8PsFP/P PP^̃ D$VD$ D$WP|$j#WjD$ Pj%Wj D$PjWjp t_^ Ë|$j Љ|$tHB|$ tHhB|$ thBD$8t @ B8umB|$ tmBD$8t @ B8usBsBBD$P_^ SVW3395#Bf=)BhP)BjWjhT)BjWj hX)BjWjo ءX)BPtEP)BP}T)BPoX)BPa5P)B5T)B_5X)B^[á1B=1Bt,P/1BHQ 1BQR P)B 1B 1BT)BQ 1BX)BA 1B_^[!B!B3áP)BP赴T)BP觴X)B3P藴5P)B5T)B5X)Bj 1B 1B;u _^[f Ajfʳ 1BA 1BAu _^[j螳 1BA 1BAu _^[1B_^[3!B!B̋D$S8t;0|9 0@8u[À;uЍJр9u8u[@8u[̃=#BVj0jYu^VtVVV=^á1B1BPV1BHN\)B51BR \)BQ35\)B^á1B 1BP1B\)BHR1B1B 1B \)BQ袲3\)B^SVt$ WU3f=)Bu ]_^[ÍF PjWj3 ؍FPjWj  ؍FPjWj  ؍FPjWnj  UjWj  ؋EPF PjPWj  ؍F$PjQWj  ؍F(PjWj  ؍F)PjWj  ؍F*PjTWj|  ؍F+PjUWji  ؍F,PjVWjV  ؍F-PjWWjC  ؍F.PjRW/j-  VjSWj  ؋]_^[̋T$S:t7<0|<9 ,0B:u[<;uH9u:u[B:u[Vt$t[F =1BtQPװFP˰FP述FP賰FP觰F P蛰F$P菰^̃SVWU3|$9=#BR9=#Bu!h#B3f|)Bj PW h贯h襯h薯h臯D$3A@=|D$ #BPQ(Bm|$bD$%!B~4|$\$t)St"33Ɋ;|8@3ɊK;};ujFjPhWjfL$3f@=|jEL$jPhQjfE=!B~<|$\$t1St*33Ɋ;|TFf@3ɊK;};uύFMB B=`)Bt`)BP蘮=d)B5`)Btd)BP{W-d)BlD$P_3]_^[Ët$l$VDU;W2D$P%]_^[øB `)BQBB d)BQ3`)Bd)B]_^[3UV3PPPPPPPPU . tB$uA tF$s ^UWVSM&ً}3ˋu F3:GwtIIы[^_̃=#BS\$uA|Z [Á}0=!B~ jS B3fYu[Ê3ҊѡBDPtL$D$ \$ \$D$ L$jj#BQPD$PhRu[Ãu 3D$[33ɊD$L$[ SVW3Uj>9- eB~j =(BUB0tG@ tP tCP|-UB0 P׋ UB1R UB1E9- eBj2]_^[Vt$V5t^F @tFP ^3^SVt$ W3F Ȁu<t5F+؅~*SPFP- ;uF tF N FF_^[j ̃SVW3U3\$j9 eB3t$UB(te@ t_PW|UB (A t4uQt!CutQuD$UB (QWG;= eB|t$jÃtD$]_^[̃ SVW3ۋ|$UGw3Ɋ@$@]_^[ D$1B51BNZ@PPWpD$7D$1B51BD$1B51BD$1B51Bl$t j}ut j3]_^[ Åut jjįt tu!ETETD$uKEXEXD$u8 H"BL"B;~1IUP ADH"BL"B; D$t j/u EXPjփWփt tuD$ETuD$EX3]_^[ @!@!@!@A@Q@a@@̋D$VT$9Vt T"B I ;wF+ƒ#^̋L$ u3áDBT$PQRHBQL$QjPF uÃSVW5BU>tV=lBjjjjjPjj׋t>U ؅t9jjUSjPjjׅt.jS >u3]_^[ø]_^[ø]_^[ø]_^[̋D$SVWU|$3ۍD$S$h$PQVSuVHBz$SSSPV,;tjU=;t[j$UWPVt=P$t%UWP t Wi3]_^[ĀÅt WO]_^[ĀÅ$j$jhTBPVFu]_^[ĀË$TB9!BD$~j3D$P迾3ɋB3fJt L$Ȁ0TBr3]_^[Āø]_^[Ā̋L$ VD$ u}t$ jQVP ^Ët$ jQVP ^̃|$SVt$WUt -FL$L$l$+ڋ+ȃ vW0FuNNG;r]_^[S1BVWUu;j5xBjjjօt&jjjjtBt 3]_^[Ë5xB1BuD$ L$T$P\$QRS]_^[ã1B|$$u=#BD$j\$jPStBu3]_^[U蚣u3]_^[ËD$UVPStBtD$ u&jjjVjWhBu(Vԣ3]_^[PD$ PjVjWhBtV謣]_^[S1BVWUu;j5tBjjjօt&jjjjxBt 3]_^[Ë5tB1BuD$ L$T$P\$QRS]_^[ã1B|$$u=#BD$j\$jPSxBu3]_^[ÍmPcu3]_^[ËD$UVPSxBt%D$ jju)jjjVh WlBu+V薢3]_^[PD$(PjVh WlBtVk]_^[VWt$ F @t F _^VVV)_^VWt$ F tBVV FP }FtPסFF _^SVt$ W;50fBsƃ0eBƃ tE|$t5P.;tCGC;uWV蝳tSLT$H|$}ߍPVlu ]_^[Í T$AB|$te|$+AQ؅tF|$++ȃ|$ɍ+@#QSBSJ3]_^[3]_^[ø]_^[SVW=B?t.t$\$VPS u 0<=tt?uڋ_+B^[+=B_^[S3VWt$;t]N>t @у:uP؅u j 豕>tƃQ C>u_^[VWt$ 950fBvBƋ΃0eBDt"VV3VX_^ _^VWt$ tujYjM;tV@PTBu HB3VtW#_^Ëƃ_0eB^D3Vt$F t+t'FP7f FF^̋L$VW; 0fBse0eB4@tB8t==Bu&t t tjj jjjjB_03^踣 轣_^̋L$9 0fBv"ɋ0eB@t] b̋D$SVW0eB4ރ{u'j{u C P0BCjDƃ P B_^[̋L$ɋ0eBƒ PBVWt$ Vu臢_ ^ËL$T$QjRPBuHBtPʡ_^Ëƃ0eBd_^%B%@B%DB%B%B%B̋D$u33f ~fBQP BVWt$ Vu,D$u=`qB @D$$<u4l$,ju+jOwQZWJDxJ}G 3_^HH ËQD$AA HA uV+ҋt$qD$ Att 9ptu3^D$Pt$ u3H D$ USEV]WPSu6w>u jw<MHXU U _^[]VWqt$|$ +ҋqt 9zt‹u3_^2R0SVWU|$u3ۋA;tquC;r*uZqC;vA(uC;wD$/JL$R ]_^[ SVW3YUt PC3|$t$t,UpCUjPHS ]w_^[SVqWك>u+jKsQ5SJDxJ}>jC ZCPOQYU G _^[V3t$W8tk!:B:u+qD$Atuuu uPr]AøUALDSVWehAu B3EEEE t t2=tT=tiuPuuP EPEPupPJ؉E^Vju(BhAuBBu:EPEPWEuuu uVBEuEPW}tuuu uVBEEEMd _^[]EEE EEEEE#BȍEPuPpEMHAøHABUSVW]1@u>f}Z;t'CE3tGEEPu hnvXB_^[] |$VuhD$=t=t=uOL$t@vBPt+BP;t2tvB3^ UdNBVWhD<@=u GtG5t 6t8t7t4uwPRuuS tGuuVu<_^]SVWUvX|$Wd+UTD$jW$B+؉D$襝xu0h<@4PBfx tjjhoWStPWU |$uPjW(BL$FG|$jW$B؅t4SAUWBUW B;u~(6AuAPjW(B]_^[USVWq}tuu Wv0BkE~uC#@u.輜xu#C(-؉F(=PBu;u u03u W6Bx8Xt 6B_^[] E F$BPjh{AjBF,uSVW豕\$L$3|#C 9F$uv,B~,s 3~$t$t$Qv,B_^[ SVW^؋|$9{t,s0>u!BPjhAjBu{_^[SVW3荛8XtF0t PB^0F,3t PB~,39FtF_^[UD$0SEVUWM EMUMUEME M$UEU(E,MU܉EHU0MԉUЋ>URW`u 3IVuuuuuuuuuuuuBu@_^[],Vt$~(u&y@uj"u3 F(A^UD$SVWu3@u }uPwG +PG+PVRE @Pu uj_^[]4 AME3MAE9At%KBtLBtLBt HLBtUJ4tjPU3ɋB8t9P$uH$EEd]øA29_t9j(ESPC FM؉EQEE(EShwXB~j7$B؋j7$B;ut Pj7(B#_^[]ÃytP\ÃSVWy?u3?jL$Q7E؋N8u 7BPTu_^[UVI(u$uuu uvBuu uvQB^] A(V袗@tVt$ 3^Vt@tjjhPXB|$ttjBf| j^D$SVWUt$Pv=YtFW܈B؋l$t0FjjEh} ME$WXB uM]_^[ VWt$>uv6tVRjvu_^D$VPL$qztD$^D$Vjp Qu^VL$tD$PtD$b^ VL$tD$PtD$2^ VW|$?u91N9HTupXQ̈BPs5wP;ȅt&WPjwv ȅt j_u_^SVW3|$7B;~8V7ĈBP5tt$PtV7ȈB;D$tF374_^[ørA<@SVW(p H_*Et3SSjwXBjjSSjw xSSj7XBjjSSj7 Bt SSjPXBuu 7Bujjh^EE_d^[]HA5M9,AUS]E UM{t;t;Su;Kr;K w]3EE[]UVEWE>Puu uuuu uEE_^] A =dE}SVWuuu S|E}Nu+}?kEPWu L}}uWkPu V} u#QRV(t ErP0jEKE3EU%k 3BE9u,EM9Au!Yj脥}DUMEA}sAjMjuq7؅tWMjY)CKEA0$0AEXjjhS؅tCU9p؋EMxMjA辤3M_d ^[]u DPU=u U0QRu PUM3SCM]GEEPEu#N4tE PutEEȍEWMPQU3ɉEMЉMME MMrDMBU܋EGEwRUEEEDpA1M$DE QWM PQUE U QRUQRu PUWUWu UW0.PE U QRUUu UWu U{QRUdQRu UJQRu U0Wu U"u PWPF+Nj΃PUu YBPUu V-PUQRu 6-PUu sPUQRu SPUEPuu 0PU_Wu PUKW Pu U7E QWM PQUE ] ЉUuWPuSUuSUWUWu UEWu UΉEPuUUWUWu UwWUlWu UE]WPUOWE U QRU8ΉEPuu UMjYgCWΉEu ЉEEtMAAAAAAA!AAALAZAzAAAAAAAAA2AEAeAxAAAAAAA;AFA[AiAAAAAAAAAAAAAAAAV"AF(^AD$A(U,SE VEW}E}uHu37MjEPj}WS}u3jjSWP_^[]蜃N9ujut˅u3USVW} S܈BOEMEN9u5uSu#EjE}EPE NPuS_^[] VtCAttyEPW4BMQSpBMQSpB]ESPBuFt$S jC +PC+PRQjW6BKjC +PC+PQRjW,B_^[] V|$ uPjPt$B^VWt$>t,WtVu;|$ t WBu3_^V|}t$pDp@p<^A+/LSVWjeu33EP]Sωu9uSBMQPtf9utaEH4tWE PStFSM)Muu EEEEuEE!A%M3 u M M_d ^[]UVWy8tl=PBt"jv$Bu}u Qvu}u PvXB2r8wu3#Mtuuu u_^]UT$ 9VWwtw+r0/vm)Nt}rvJtB28E 2}EWEPUjh)?utpuuu R [E}jP}}WE NPj4E jj Pjt}t3_^]fD$Vf=tf=ujt$hu^f|$uz@uj3VW phD<@dNBА9~u @PB2-xu+#t"z#9xuh<@4PB蔐@tЋ@ujjjjjwg_^VW肀xu-h<@4PBC#t#9xu F$tjj_^V"t"9put$ H"]@u4jjp ppv^SVW.@u]y"tp"Rxt=j=Bf|.jf|%jf|jhFhvXB_^[Vi@9pu @PB[,@usjjp ppv^D$VL$Qp/tD$g^VL$t juC^ VL$t ju"^ VWj!D$ WWjPlBt D$PhBD$jWWjPlBu_^D$VPL$NtD$^ USEV] WPtEBhD<@dNB܍tKwwEuQpu CG_^[] U VWutd}t]EtUtQtLuju {?t9EPj WxBuVB}u jHBEuVpB3_^] &A((SVWM̉euVvVEM3EEEPEEEM_^[EMd ]hj0uP$&%Aø%AøA\D$T$QAU0SVWپEtpu:@t sB js BtjjhkVXBtEPs4B@uJtjV$Bt t3jEPjj0`Bu u}Хt7F$ttSyh3PPPPP;t jW`BtTB;FuWtBP\F,]_^[VA$t t$Pxt$vPB^Vt$.-P΋.^SVWpHt2VXt+FLRt PVS v@VSu js35t&F%t jjvLBP|ȅt3_^[0pxu3Wt RxtT$RjjhFRuoHD$PjjhFPVALtP v@u j3LjMu j32hF?t2΃P^Vjt j2^j)SVWqHADy@toX jw@SBPSBt PBt7f~u fNF fVfN fV ufu fҸt3_^[t$ t$ t$ f Vt$ uAEWV~jQZӉE9} t9~uEMP}VWvPE_^[]hBLBøBËt$Vt$ tt$u3^ø[=A A SVWeu3M_d ^[]3ɉMMЉEEE֋MA=AøA VWCejyt$ Oojy_^t 9L$t Iu33(eP(L$H(VW=At$ u!;=Audx(t t$ ׃u͋_^t$øBV^VW|$ A8| PtBΉ7w_^VWt$ u F PID0 pp _^V+ B t% PdB P@E^Vt$;5BtVdB V^x| hhBVW9 ?~"uw΃ ,G@PW6 _^UV yE9A}8u^]V+ B t PdB Pi^VWt$ VVt$7` q_1^Vt$WtVBVP_^USVWp>M9H}2X;]~]u9CN PQ7 VY_^[]VD$u6BA^VWt$ Vup0_^UD$VWuut3P3Vju WWhB~f|F_^]USVWWPud+؃vP7WPPu(؋+Ã~j3_^[]Vt$t$Vt$Iap Bu^ UVu t[EMEPVtt5Fu VB+PMVPPP  M3^]jt øzBA SVW3`9XuI9]tDhfAjDE];tjjhB" 3EWFPFMd _^[]ø8Bu~jht$U UV3VHutMQuE^]VWq>tjȅt6}_^Ãyt PBAVyu0tjzx^VWtRx3PG|PhjvDBt$t$Pp_^T$SVWBt\tW3=u9r u |$hBtSh0hBu SjP Rt$_^[USVW39=PBt^@tPT]BSENxtPE}t+NxEPPȋ}u uS@tPX|3_^[]USVWPBH}WQBugjEPW+vtWƌtPO!3SSSWuSvPjB\BPBjSPWuSut 6!uu_^[]]@VI]xud`VBuuVBPjhHAjBh<@4PBF4lpt \phB@8PBl^Ãy$t tjP3ÃSVWU3ۅt)3UF0UUUPlBuSËCPdu3u3΋P`t*F0PPht3UF0UUUPlBu뜋΋Pl]_^[SVW|$_tttu233WqT9uG9AXu 9Y\tZ^GA\_^[A8USVW39}qt4Ft-PBt"WcjSvV@jjWjSvc[X{te;tauPsBu?|'jjhcsS޶jjjjhcs~Pk[Tu}|4[xu }|3_^[]VWt$ F=r=v=r=w3ɅuT=tM=tF=t?=t8=t1= t*=t#=t=t=t=t=uQtRxtGVPt%t6<;;t V3_^D$Huu j0B3UYxu#}} }uMuuRtuu u Sp4B] U SVWًu pEt =V6stvtiEt^PtXt Rx{t8Nu~ tujhFhpXBht_ȋPx=PB3s-t)VtjhFhwXB39}uy9{ ttF=rj=wcQE9uSM}ǁK t#E;PW\tMǁMǁ3_^[]D$Vxu7xpu1@ @u&j5Bf|jf|jf}3^A uAu TBP贵V3WPP~0PW Bu3(~4jtWP\uWBWhB_^øKAEEVMA,AMFd ^]ø(BM6LA4EVMA,AEMNMd ^]PBVMy~ tjPËD$ 3Ʌt|$t D$t3 UE|PhRPtuu|R "M u uuQ"]3V@SVWU&VxHUpttjjo 6,OX tP ;sGư>t<3tP 36/ut U]?_@^[øMASVMWyj 3jjω]^SEjשEM UF8_Nt'\t/u H\t/tP 8uـ8tQ8t(\t/tP8u8tKP8tF\t6/t1P8u!ƀ>t\t/tP8u8t@L$jX_^USVWLuuu uxat1t#STuOtP\SlSXGf_^[]VA3EVMAAAAA EM^d ]øAMEVID$t V:^jtøjWASVW3K9XuI9]tDhfAjDE];tjjhB23EVG`GMd _^[]øAujht$eVt$Wt&j?ȉwV\ω8wP_^SVqWً>tjt 6P_^[øVXAAM3ɋEM9HtPBEEd]ø0AMD$AD$AAAÃVAt PBD$F9FtPBtD$D$^VI9Nt t$QBNttt$QBu3^t$t$BPUVWuBF9Ft WPBEFt WPBEu_^]UVWAu9GttNQPBEGttNQPBEuO_^]UVWAu9GttNQPBEOttFPQBEu_^]UVWuO9OttFPQBEGttNQPBEu_^]UVA9At uPBEFt uPBEE^]UVA9At uPpBEFt uPpBEE^]UVA9At uPBEFt uPBEE^]UVI9NtEPuu QBNtEPuu QBU^EM‰J] UVI9NtEPuu QBNtEPuu QBU^EM‰J] UVI9NtEPuu QBNtEPuu QBU^EM‰J] UVI9NtEPuuuu QBNtEPuuuu QBU^EM‰J]UVI9NtEPuu QBNtEPuu QBU^EM‰J] UVI9NtEPuuuu QBNtEPuuuu QBU^EM‰J]t$qBUVA9At uPȅBFt uPȅBEE^]]AVMEMVRAAPFȇBPuEƋMd ^]XAM$VD$t V ^Q^AAMAEPq̇BMEEd]øAMjtø^ASVW3SD9X uI9]tDhfAjDE];tjjhpB3EWF F Md _^[]øArujht$Vt$Wtj?ȉwVҙ8_^VWq>tjȅt6_^Ãyt P̅Bø`Ae3EVMAAAuu uEAԅBP>uEƋMd ^] MAWM鯿`A3EVMAAAuEAЅBPu4EƋMd ^]MoAM-D$hAD$MBPsÃD$h8BD$LBPUU} SVWu3G$w(+M ;rVPu ] w$u+ˋ+3w+ʉMMuO uP<E)Et}u+;uuEG;w3EG,EuO uP<E)Et }t;r܋G,G$ƉG(O w,G(PVwjPXO$G$w(+;rV+Pu= w$E +_^[]SVt$WUtwG$o(+;r\$USP o$+tQϋO+w+O U+SP@tO o,G(PUwjPXMO$VSw$ w$]_^[SVWAtV$F(;t N j+ЋRP0F(F$M^,t9V$t?N ~$~u 1+PRV@"jj+PjPXN V(RSvj1VX_^[ÃSVWU~u`N$F,;~(+~WQPD N,N$)~(^n,+N SUP<+؅t t;|$rF,F$ljF(0V$^(;t N j+ЋRP0N ~,SWvjSXN$F(+F$;D$s jj]_^[SVWًt${$s9C(sf03;C(vf;C(vn0_^[UVWq$A(Q;v +ȃQff=t"G(J;v +ЋσR_^]jAjjpXBU Vuu39jV$B;E u#j EPVBh(AMQ@B^]UD$ VPuBju BtQV܈Bf=t5jV$Bt%EPV4BU EuUuPBujV Bu3^] UVWu VB;w'PPu؈B;uVPBt VuB_^]VWt$ 3t P̅B>_^VWpBtdt$ ;t\jWuWB;ƋtCjW~t7t#jV$B@tVBB;tjjhOWXB_^VWt$ t*V+P6H3_^øgAEVWt NM3F MP}EE9xu hMFMuPQX u uu8BE#E)Md _^] M BMHhASSVW3jE]tI΍~ E5Eu EAFƈ]M bMJ3Ehx BEEPE_d^[] BuƶVt$ F ^UVEPuN}uWF EF^]V9t&FtP|B~ tjjhvXB^U VWu }h?t6j EPV؈BMUQuR:u0jju{EUPuR܇BMQV#_^]UL$ ASV3t E3jjhWXB@ttjhWXBt"EE+ÃPhWXBCjW BtjW$Bt_^[] lADVWu39>tmu uURB EuuPB M]MUQ}RMuQuj0uMEE_d^]BVMTUD$ 9D$9E}hhPAuuu.]UD$ 9D$w9EshhTAuuu]UD$ 9D$w9EshhTAuuu]Vt=tEj1P8t{ȋPx΅u^VWq3WWpBjWWWWhLBz_^SVWjI\$É~PBPB~>uBjI_^[VtRxttNht 1t$Vh^USMVWjEPjWuƔtޫȋ؋tsLEtE uE v r wM 0-tOUu rpuQB}t ju`BjM_^[] 4t$ t$ Ht$  $oAGMVPuEMuuu3HVu 1uEEEMd ^] BBM@Ixt`(ÁV>t$ L$Q$ P^Ixt$P$Ixt t$P,UujEMuP]Ixt t$P8VWt$ P4uV_^UVWytt8u9u3QjEPjju VTBVLB+uhLAMQB URu uDB_^] UhPu tuuRu]USVW3} ߀?tJ %u.C<1|'<9#ȃ1;M}$EtPBABtFCCF;uV]?t]%u;G<1|4<90ȃ1;M|?2Et)PVBVBABtGFGF?u+3V_^[]D$ jPt$t$ UD$MjEMEPu u]VWBt$jjheVXBVnupBt jjheVXBu`VBu萧u3@PBt jjheVXBu!VujhGhwXB_^VALt=t/HjvL1^Ujuuu ujhAPX]3sA,AEMbEEd]ø`A3MlVWt$ u3/7VTrPjt$(B>u_^SVW|$t$wЈBt P?O4t6t$ST؅t's ss B;GtW3_^[.x,.L$H0.@0RBRB3RBRBøPAø/uASVMW3覈Nlj }蝀EELA^@~D~H~hFXPF<,B~P~LΉ~T_^]M[d ]ËMRMl~0 B7MpVD$t V^uALAEMiE"E'E0Ed]ËMMlh BMڒV-VH6^V,VH6^V,t$p 0BFH^@VqHtt^VWt$ F=t=u6V踔tOOhtVPXt7F=r+=w$tVPw4Bt3_^tjPV>Nht 1t$Vp^VIhtPtu ^ÃSVWyPtX~jgL$SS7QlBu jjS7DBB;u$B誢3QNPQHPhj7DB_^[V脢xPtPBPBt^ VWt$u' t t*HjV3_^t3US]VW} xPtPuLFtDG;t;Et3SjhevXBujWhvXB u u蚟_^[]D$;D$tPu3SVWU@3 jBP BtFUBt,Ut"UstjjhlUXBuGjU BuƤP3vjBP Bta|$UBtCU臇t9Ust,jjhlUXBujGU`BD$D$,jU Bu]_^[VWtOHuJt>8t)348xBt j48`B<8u6_^SVWUjBP Bt{W褆؅t[F;tTWPtIjW$B|$u"#́ujWBK$|$tuC$t jWBc$jW Bu]_^[SVW|$tF$tjIj|B^3BP˅u}uuN$2tIF$t'$ΉF$TB;ujjj3XBtF$ tjjh3XB΃P_^[SVWًU@u Vt$ tEXu$t ;tK%jjhwXBc%jjhwXBjBP B؅t+SwmtjVhmSXBjS B؅u_^[Vt$~(u&R&@uju30F(AF Āt=PBt@F =PBtN-^USVW3];t#%Sp 8Bu3au Eu3@u$WUPJB +PB+PQ2uu uu 8utWB3_^[] USVW] 詿u3T3SMMUMu VRMhPQQPXu3'=PBttt j jQ{_^[]D$t8thPltD$0PVWu<>t$t$t!jhhbvDBj3_^UXSVWN$M Qp \BtVj0EjP, EMEQS`}t/EPu$pBt9utVuuu豏3_^[]A&SVW}M3ۉ WM]tj SuQ]#@uj*u!E3M_d ^[]Wu ߋ}WjSuhRBu P$tv̈BSΉFD\ujjjjhdvɛEx BM锿VWt$ ut uwDVwNhtft ft3PS\9pu,u tPPj3_^[SVWUًa};@u <؋t$l$t;t)!;u;tjj@hmuXBu3$$߅ɉt Pf`؅uI؅t%t|$uSSjWV]_^[ VWA$ ut$ 胲u3jVh_^WGL$xPtwtKtC.|_ t00t(@t Pt`t t0uQjhewXBujhGhwXBUSVW3qtBP^|WWjuBXt,hPWuBPG;ruB_^[]VH9qu^VW|$ xt9wujjpPl_^USVWpxfE fU ft{ff;uof9udhPQBPBf hPQBQB  QvhuXB3_^[]USEVWPMQu W5uBhPQ8BuBuhSWu 4PvSuDB̯tLHP3_^[]t$qht$DB3Ët 讯`yu3@_^V蝶t蔶Rx;u~PL$@1PV L$A^VĀt3Nht Plu#|$t tpj^UVW豥@tnƅ}tKWPBF@~$PhHAQBQB hDAPBQBeQB}tKhDAPBWPBF@~$PhHAQBQB Pv;_^]USVW}EtHhtjP`3ۋFp} E;tzMIUMq܈BȉMrOwGMEt ]Mt }tjG#EPu}u_39]GSΉ37vЈBSEPBv̈BG;tjSvdBSv uE t OhtPTӡ ts3۸S]M]QEQEjhhSjMQWXRjhhSވSMQPdjE+EPE+EPSSS jGXjPjhhj虈_^[]UD$Vttt&^]jju jhhjO39U u#AX9u9Q`u9Q\u 9Qdu3P,Bu qXVBu u VB3Vk|$t j^ ukVWt$ u&wBuw8Bt VtV-V_^D$t$ttttqBPHBV(uFl^VtFxFpt xxu3^øA贸Vju VB_^A۞SVWuF P B^ PB؅t U9S }  uojEEt AEEdA Mo3E3CC >u F P BSN>u F PBC ~u#Pj,B" Bku jQPBC { u>u F PBDC+QjC P] Kt SPB^UK E >u VBE_d^[]ٰAbME+EtuPEMd ] B鍔M-U SVA WP Bt PB~EE~_E}t!MVE9D tG <t#EG tjG EEE9G}t7WN w 4Btjt jPBF VB_^[]VW9u7=OBu!OBtj&OB OB OB\>OB0Bt 9x~@ <3uT$ P6 OB_^Vt=OBt P OB^øtAw =OBSVWeu8Bt <r3OBt P\OB OB3}OB P B9>u OBz6 OBEuUEP6 OBOB PBEEMd _^[]OB PBjjš9Aø Bt=OBtP OB<3Vt=OBt P OB^Ë OBt t$ OBt t$?AAM3ɋEM@tQЋE@tPBEEd]ø8 B'MLjA譙AMV34PBut @tEE^d]ø` BȐMhhɴAøA5EEd]ø Bz8PBahA˔øu5hAPBxPu膝_^[]VW|$ ?t)<\tt$j V誘pVuBj@ttjj3%t 6t38Xu$F4t PB^4F03t PB~0]_^[AA @ @@ @0@1@@1P@1`@ 1p@1@1@1@1@1@1@@@@0@@@@WLAAeA>@@0@@@@WLA(AA=@@0@@@4LAWLA%u%d%ld%lu`A|AA/AAAPAAAbACMenuAAB@@0@@@CA!CACWinAppRecent File ListFile%dSettingsPreviewPagesAAAA dA,oAoA@AףAAҦAA@0@@@7A6:A9A9A9A9A9A$CA$:Ar:A0:A*:Ag:Am:A}:Ax:A?A*CAGA-KADAlFAACA6IAKAEAoAHoAA6oAmA5mAoALCACWinThreadAߧA(A@0@@@7A6:A9A9A9A9A9A:A$:Ar:A0:A*:Ag:Am:A}:Ax:AEAEAGA-KAFAlFAFAHA6IAKAEA8AbC@SoftwareCNotSupportedExceptionCMemoryExceptionCExceptionAA}C@@0@@@@WLAAAC@@0@@@@WLAcomboboxCMapPtrToPtr8AAh@@0@@@AASystemCArchiveExceptionAA-D@@0@@@fAWLACPtrList(AAo@@0@@@CFileF FFF.INI.HLPCControlBarCViewCFrameWndAXAևA0JAu Ab Ac pA!AA AA }A A AVAuAAAA3 eA#ۄA A wA zA#vAvAe wAf xAn 2A,ڌAA,ڌAA,EA,EA,EA,EAEE,AN)OAN)OA .A A AxAAAuA@0@@@hAh A9A9A9A9A9A>tA$:Ar:A0:A*:Ag:Am:A}:Ax:AAbA| AO|A?A AArA5*A<*AxAA A @xAyACvAd4AAA AvAA'A+A/A~AAڒA?AݒAA;AAΓA}AAAvA\AwA - :%dCFileExceptionL@M@AM@csm H:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunb@b@}d@Vd@cd@f@f@Jg@Rg@runtime error TLOSS error SING error DOMAIN error R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...}@}@}@-~@~@~@SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecTZLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALL.GetLastActivePopupGetActiveWindowMessageBoxAuser32.dllunited-statesunited-kingdomunited statesunited kingdomtwnturkeyturtaiwanswitzerlandswedenswesvkspainsouth-koreasouth koreasgpsingaporerussiaprtpr-chinapr chinaportugalpolandpolnzlnznorwaynew-zealandnew zealandnetherlandsmexicomexkoreajapanitalyirlirelandicelandhungaryhong-konghong konghollandhkggreecegreat britaingrcgermanygbrfrancefinlandenglanddnkdenmarkczechnchinachecanadacanbritainbrazilbrabelgiumbelautaustriaaustraliaausamericausausukturkishtrkswissswedishsvespanish-modernspanish-mexicanspanishslovakskyrussianrusptgptbportuguese-brazilianportuguesepolishplknorwegian-nynorsknorwegian-bokmalnorwegiannornonnldnlbkoreankorjpnjapaneseitsitalian-swissitalianitaislirish-englishicelandichungarianhungreekgerman-swissgerman-austriangermanfrsfrench-swissfrench-canadianfrench-belgianfrenchfrcfrbfrafinnishfinespesnesmenzenuenienglish-usaenglish-usenglish-ukenglish-nzenglish-ireenglish-canenglish-ausenglish-americanenglishengencenaelldutch-belgiandutchdeudesdeadanishdanczechcsychtchschinese-traditionalchinese-singaporechinese-simplifiedchinese-hongkongchinesechichhcanadianbelgianaustralianamerican-englishamerican englishamericanButton0@P@ListBox@@Edit@@ComboBox0@`@Static@0@0ComboLBox@ @CToolTipCtrlAHAl @ @ U@CMapStringToPtrBAA AAABBBHBPA`AApA0BHBBABAAAA A ABBBPA`AxA AAABBAAAABAAA0BA ApAB@APAhA AAABBAAAAB0BAAAAA0BHBPA`B`ApAAAAAAAHB`BBAAAAABB@ABPA`ApAAAAAAAABBBBAAAAAABB@APAAABxAAA ABBAAA ABBA(A8A ABBhAxAA AB@BAAAA A@BBAA(AABBXAhAxA AB BAAAAAAB BBA(AAAAPBPA`ApA APBBAAAAAABBAA AAAAB`BPA`ApAA`BBAAA ABBAAAAABB@APA`AABhBAAA AAAhBBAAAB 8A@@@@@ A@k@  A@@@@@@@@@@@ *@ 2@ 8A_@ `A@ A@ A# @ A @ AT!@ (A!@ PAi"@ xA"@ A#@ A\$@ A(@(@(@ (A.)@)@ XA1*@ A*@ AO+@ A1@ A5@  A96@ HA6@ pA7@ AZ@ A@ AAAB@ @AA hAxAABA A<@ A> A A A8AB\A hA]A AAAA AA AAAhB&AB%A XAA A=@<@ Al-A A/A.A A0A 0A}7A XA7A A=sA AAABM=A AVA (AtWA PA`XA xA]A A[^A A^A A`A`A  A`A`A PAAA AFA AטAA A:A AA (AkAAA B0BBHBhBAAxAXA8AAhBBAxAXA8A B hB=@ B=@ BO>@ B>@ B>@ 0B@?@ XB?@ B?@ BlA BtA B,A  BA HB'AAA BAAA BA BA BxA 0BA XBAAuAjA BAyAnAcAAA"AA5A*AHA =A[A PA (BܡA PBtA@IA@ BZABA4A BA BA@ B+B@ 0BB@ XBBA BcA9A BB@ BϣA BA (BؤA PBSA xBA B.oA BA B;A BYC@/C@ HBKA pBLA BA0A BA BA$A  BsAB(BAxAXA8AHB BpBAxAXA8AB BC@  B%D@ ( BMAMA X B`@  BI@  BAA  BA  B B( BBVA X BIA  BA  BA  BFA  BgAgA ( BRhAhA hAB@ BxAXA8A` B  BD@D@  Bg@  B@ ( B UA P B9uA$uAuA  BuAuAuA  BA  BA  BA 8 B=A ` BߺADAApx@ئAAA @P6@@@F@@@A•AAؖAAAA,AAA, ڌΌZxj&L>ʋ֋nz0^N Ԋpx &@P^l•ؕ"*6DR^p|–Ԗ"2FTdpȗؗ,>XL:Δ~l`T>2  ؓznbR@,ޒ̒zhR>2֑đrbH8,  ސҐƓʛ؛2&Κ 0P˜Ҙ0@$R^lFҙh4(TbHzpt^čލ$6`ڎHTnR`~̏ޏ"4FXrl`VH8* ؉jV >, ڌΌZxj&L>ʋ֋nz0^N Ԋpx &@P^l•ؕ"*6DR^p|–Ԗ"2FTdpȗؗ,>XL:Δ~l`T>2  ؓznbR@,ޒ̒zhR>2֑đrbH8,  ސҐƓʛ؛2&ΚPlaySoundAWINMM.dllGetCurrentThreadIdflstrcatALockResource}LoadResource~FindResourceAGGlobalFreeQGlobalUnlockKGlobalLockMulDivilstrcmpAulstrlenAgInterlockedIncrementeInterlockedDecrementBWideCharToMultiByteMultiByteToWideCharGetCurrentThreadBGlobalDeleteAtom@GlobalAllocCloseHandleGetPrivateProfileIntASWritePrivateProfileStringASetLastErrorGetLastErrorrlstrcpynAllstrcmpiAFGlobalFlags~LocalAllocLocalFreedInitializeCriticalSectionTlsAllocDDeleteCriticalSectionJGlobalHandlewLeaveCriticalSectionMGlobalReAllocOEnterCriticalSection!TlsGetValue"TlsSetValueLocalReAlloc7GetVersionFreeLibraryGetProcAddressxLoadLibraryA GetProcessVersionSizeofResourceolstrcpyAGetCurrentProcessOWriteFileSetFilePointerFlushFileBuffersuFindCloseyFindFirstFileA:GetVolumeInformationAGetFullPathNameAGetModuleFileNameASetErrorMode>GlobalAddAtomAHGlobalGetAtomNameARtlUnwind3GetTimeZoneInformation!GetSystemTimeGetLocalTimeGetModuleHandleAGetStartupInfoAGetCommandLineARaiseExceptionSHeapAllocYHeapFreebExitProcessTerminateProcess]HeapSize\HeapReAllocGetCPInfoGetACPGetOEMCP&UnhandledExceptionFilterFreeEnvironmentStringsAGetEnvironmentStringsFreeEnvironmentStringsWGetEnvironmentStringsWSetHandleCountGetFileTypeGetStdHandleUHeapCreateSetUnhandledExceptionFilterlIsBadReadPtroIsBadWritePtriIsBadCodePtrGetStringTypeAGetStringTypeWuLCMapStringAvLCMapStringWGetLocaleInfoAGetLocaleInfoWCompareStringACompareStringWSetEnvironmentVariableASetStdHandleKERNEL32.dllGetClientRectSetScrollPosHInvalidateRectEnableWindowkLoadIconASendMessageAAppendMenuA"GetSystemMenuDrawIcon#GetSystemMetricsYIsIconic3GetWindowRectRegisterWindowMessageASetWindowPosSetWindowLongA0GetWindowLongA-GetWindowGetMessagePosGetMessageTimeCallWindowProcARemovePropAGetPropASetForegroundWindowGetForegroundWindowGetLastActivePopupSetPropASetWindowsHookExA.UnhookWindowsHookExCallNextHookExRCreateWindowExADestroyWindow}DefWindowProcAGetKeyStateGetDlgCtrlID5GetWindowTextA6GetWindowTextLengthAGetDlgItemGetMenuGetMenuItemIDGetSubMenuGetMenuItemCountRegisterClassAGetClassInfoAIwsprintfACWinHelpAGetCaptureGetParent]IsWindowEnabled'GetTopWindowSetScrollInfoScreenToClient_IsWindowVisibleEndDeferWindowPos=CopyRectBeginDeferWindowPosDeferWindowPosEqualRectAdjustWindowRectExSetFocus\IsWindowSetActiveWindowGetFocusPeekMessageADispatchMessageA GetSysColorMapWindowPointsSystemParametersInfoASendDlgItemMessageA7UpdateWindowPostMessageAECreateDialogIndirectParamAGetActiveWindowEndDialogGetNextDlgTabItemVIsDialogMessageA SetWindowTextAShowWindowEnableMenuItem-CheckMenuItemSetMenuItemBitmapsModifyMenuA GetMenuStateeLoadBitmapAGetMenuCheckMarkDimensionsGetDCReleaseDC/GetWindowDC BeginPaintEndPaintTabbedTextOutADrawTextA;GrayStringAKwvsprintfA(CharUpperAwLoadStringADestroyMenuPostQuitMessageShowOwnedPopupsSetCursorMessageBoxASetMessageQueueGetCursorPos;ValidateRect,TranslateMessage GetMessageAGetClassNameAPtInRect3ClientToScreenGetDesktopWindowgLoadCursorAReleaseCaptureFWindowFromPointSetRectEmptycLoadAcceleratorsA)TranslateAcceleratorArLoadMenuASetMenuReuseDDElParam2UnpackDDElParam BringWindowToTopUSER32.dll BitBlttTextOutA,RectangleGetTextMetricsACreateCompatibleBitmapCreateCompatibleDCGetDeviceCapscSetTextColorBSetBkColorGetObjectACreateBitmapCDeleteDC5SaveDC3RestoreDC<SelectObjectGetStockObjectCSetBkModeRSetMapModefSetViewportOrgExOffsetViewportOrgExeSetViewportExtEx6ScaleViewportExtExiSetWindowExtEx7ScaleWindowExtExGetClipBoxIntersectClipRectaSetTextAlignFDeleteObject7CreatePen@CreateSolidBrush(PtVisible+RectVisiblecExtTextOutA\EscapeGetTextExtentPointAGDI32.dllcomdlg32.dllClosePrinter6DocumentPropertiesA_OpenPrinterAWINSPOOL.DRVRegCloseKeyRegCreateKeyExARegOpenKeyExARegQueryValueExARegSetValueExAADVAPI32.dll DragFinish DragQueryFileASHELL32.dllCOMCTL32.dllGetProfileStringA^IsWindowUnicodeCharNextAOffsetRectAInflateRectwDefDlgProcADrawFocusRectGIntersectRectExcludeUpdateRgnShowCaret=HideCaret3UnregisterClassAPatBlt%CreateDIBitmap3Pp `x33gyyy 38P3dhfx3 (@Xp3y333 03 @3 P3 `3 p3 3 3 3 3 3 3 3 3 3 3  3 03 @3 P3 `3 p3 3 3 3 3 3 4ȧdlЯD($X|XԽ`dt*JJ8dDdl,""0( @80p`????? p( HxHd)9|x0!?(F'|Kpxzpxzz`zzz܀zzzz zzxxxzpzzz zzxxxzpzzz zzxxxzzzzzzÈpxzpxzz:wwwwwwwwwwwwwwwwwwswwwwwwwwwwtwwwwwXwww wwAzzzzzwwwzzzzzwwwhzzzzzwwwzz zzzwwxԊ{x{wxxxwxxwxxxxxxzzzzzwwwwwwwwwwqzzzzzzzzzzzz zzzwzzzzzwwKzz zzzwwxzzzzzwzz zzzwwzzzzzwwzz zzzxwpzzzzzhzzzzzwwwwwwwwwwwwwwwwwwwwwwwwwwwwww( Pwww(' (! wwwwwwwxwwwxwwwwxwwwwwww( @xxxwwxxxwxwxwxxxxxpxxxxxwxwxwxwxxxwxwxwwwxwwxxwxwxwwwwwwwwwwxwwwwwwwx??( xxxxxxwxxxxxw???ȀdAbout PolyDiceMS Sans SerifP P( Polyhedron DiceP(Copyright 1997, Marshall J. HornbergerP"(5@52>4 2006, Lex RemPOO OKP(Version 1.0P1P8-B0 ?@>3@0<<0 15A?;0B=0 8 <>65B @0A?@>AB@0=OBLAO A2>1>4=>.ʐK=>3>3@0==K5 09AKMS Sans SerifPa2@>A>:Ps20:@KBL P ' @C3>9 P ' 2-AB>@. P #' 3-AB>@. P -' 4-AB>@. P 7' 5-AB>@. P A' 6-AB>@. P<' 8-AB>@. P<+ 10-AB>@. P<#+ 12-AB>@. P<-+ 20-AB>@. P<7+ 30-AB>@. P<A/ @>F5=B P?V(PgU msctls_updown32Spin1 P?h(Pgh msctls_updown32Spin2 P?z(Pgz msctls_updown32Spin3 P`< Pr<Pw=PiJ"8? 09A0Pk:>;-2> 09A>2:P}6>48D8:0B>@:PxUs280?07>=Pb&8=8<C<:Pu'0:A8<C<:PwB 57C;LB0B 1@>A:0:PX9>;-2> @>A:>2:Ȁ.?F88MS Sans SerifP9 &2C:Pe20Pe2B<5=0PT &>25@E 4@C38E >:>=Ȁ FNewMS Sans SerifP{&>2K9 P}1dP(0P(B<5=0P+(F&><>IL &@>3@0<<5...&?F88 PolydiceAppOpenSave AsAll Files (*.*)Untitled&HideNo error message is available.'An unsupported operation was attempted.$A required resource was unavailable.Out of memory.An unknown error has occurred.Invalid filename.Failed to open document.Failed to save document.Save changes to %1? Failed to create empty document.The file is too large to open.Could not start print job.Failed to launch help.Internal application error.Command failed.)Insufficient memory to perform operation.Please enter an integer.Please enter a number.*Please enter an integer between %1 and %2.(Please enter a number between %1 and %2.(Please enter no more than %1 characters.Please select a button.*Please enter an integer between 0 and 255. Please enter a positive integer. Please enter a date and/or time.Please enter a currency.Unexpected file format.V%1 Cannot find this file. Please verify that the correct path and file name are given.Destination disk drive is full.5Unable to read from %1, it is opened by someone else.AUnable to write to %1, it is read-only or opened by someone else..An unexpected error occurred while reading %1..An unexpected error occurred while writing %1.#Unable to read write-only property.#Unable to write read-only property.#Unable to load mail system support.Mail system DLL is invalid.!Send Mail failed to send message.No error occurred.-An unknown error occurred while accessing %1.%1 was not found.%1 contains an invalid path.=%1 could not be opened because there are too many open files.Access to %1 was denied..An invalid file handle was associated with %1.<%1 could not be removed because it is the current directory.6%1 could not be created because the directory is full.Seek failed on %15A hardware I/O error was reported while accessing %1.0A sharing violation occurred while accessing %1.0A locking violation occurred while accessing %1.Disk full while accessing %1..An attempt was made to access %1 past its end.No error occurred.-An unknown error occurred while accessing %1./An attempt was made to write to the reading %1..An attempt was made to access %1 past its end.0An attempt was made to read from the writing %1.%1 has a bad format."%1 contained an unexpected object. %1 contains an incorrect schema.pixels @4  (04VS_VERSION_INFO?StringFileInfoj040904b0LCompanyNameMJH Software ConceptsZFileDescriptionPOLYDICE MFC Application6 FileVersion1, 0, 0, 12 InternalNamePOLYDICEt(LegalCopyrightCopyright 1997, MJH Software ConceptsB OriginalFilenamePOLYDICE.EXEJProductNamePOLYDICE Application: ProductVersion1, 0, 0, 1DVarFileInfo$Translation l 000F0S0{001"1w1111D2227355$5\5567X88:3:::::::;;; ;;b>>>?\?b???? 0<0B00000&1K1l1122E2`22233L333 44S4M5666 7>7P8X8a8j8r8{888999999(:L:x:::::;3;F; <@>F>X>f>>>>>>>7?I?W?????@0010W0}0001 1@1k1~111"252222223)3P3~333334.4A44%55c6677R8l8u88889W9f9l9x99999999:!:,:1:::::::::: ;;;;;;;;;;;;;k>>>!????P 00S0X0\0`0d0000000_111111 2<2@2D2H2L2223334 4r5516<6A6N6S6666666667 777#7>7I788:8H8r88888989H9Z9|99999999:::<::::::::::; ;;;;4;A;F;L;Q;};B>>>??p%0/0@0P0\0z00011)161v11112-2c2j2222223@3N3333344445 55*535Y5f555646i6666666666 7A7`7z777777788808b88888888999R9q99999:$:[:< <$<7>>>>>>>> ???*?1?@?G?P?X?^?g?w???????????T0=0l000001:1A1J1U1d1r1111112 222*232<2J2S2\2e2n2{222222222222233^3g3q3y3333333334D4M444444 5'525N5g5q5{55555566p66666777.787B7X7^77778-8O88888899&9J9a9x9999999: :::#:+:0:B:L:d:;;;;;;;;;; < H>i>>?D?????00L0c0o0}0N1y1122)22223333#313B3X3f3: :+:?:S:g:y::::::::::::; ;;;#;0;9;A;O;];n;t;z;;;;;;;;<Y>>>>??_000u1111111112-2;2W22y333 4/44444575I5_5k5}555I666!7/777V8`8889(9Q9999:9:g:s::::; ;;;;";@;H;p;|;;;;;;;;<<.<8>>T>s>>>>??D?~??0>0h0~000011 1111$1*1]1x11111111111111122 22C2V2w2}222222222222223 33 3*30363<3B3G3M3a3h3n33333333333333444%4.454;4R44444444555+5;5M5U5^555555W6_6m66666R7o7777788!8'8/848R8X8i8o888889&9S9n9|99999:<:F:^:l:::: ;;5;C;I;V;\;b;g;l;w;~;;;;;;;;;;;;;<>>">+>5>>>H>Q>[>d>n>w>>>>>>>>#?^?s???? o0w0001&1e11111122=2G2M2u222223y333333333333334%4*404S4]4n444444575@5S555555556#6?6c666d77777788-8P888888#9?9M9\9c9k9999:5:N:f:::::::::-;N;d;n;~;;;;;G<<<<<<<<==)=Y=i=u======> >>>>>>>??( 0+0o000000011611111122 22222 2$2(2o2w2222343N3y333333414C4R4b4444444444445 5L5b5n5u5}55556*636:6^6u6}66666777Z77 8,8:888888X9w9::;:s:::;0;D;e;;;;;<<<==5=G=p=========>->>>>>>>>>>>>=?E?g?????%0`0f0k0r000000000000011 151O1Y1t122223"30334434L444444 5"5(5^5555777W788@8;;<<<-<6<<'>Q>3?9?P?????P0s000111222222P3V3334%484A4455T5p5|55555556.6B6Y6a6i66666637F78U888888859 ::,:K::;;d;};;;=q====== >2>m>s>>>>>>>s???? 00T0f001_23074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|77777777777777777777777777777788N9q99999::::::;";T;q;;;;; 2>b>>>???? 01111162;22(3Q34&47444*545B5O5m556 6_6l6666666677777s8 919M9o999 :Y:{::::;I;j;;;;(<< =.=c=u=/>8>L>>>>>?O?X????00c0q000011z1111Z2333444 5'5p5556/6P6o66!787>7t777788{9999999999999:%:+:1:s:::::;p;;;;;;;<;<<<<=V=\===>D>>>>> ????@e00m112#2I2{23%3}3334445(5v55555555 6S66S78.99:.::";<;`;g;t;;;;;;;?P???????P 0V0g000-2k22n333333334$4J4W4444445;5e6|6666797k7 8898W888889.9@9R9999:B:`:::::;;I;a;;;;>,>R>z>>>>??????`0"090?0R0Z00000044444455"545J5W55555556'656=6Q6g6|666a7777&8I8889=9:H:w:::;);O;Y;h;{;;;<:>>%?pM0V0g0q0011s1z111 2%2;2d2z2222343y333(4-44494?4E44405`5n556667G7M7W7u777`8u88889-9]9d9u9999 ::J:Q:::::: ;R;d;;;< <<6>m>>>v???0.1>1Z12*23F4_4x444455555 6#6,6L66858D8S8r88889999:6:::;;;<>4>>>i?|??????????`000011(1;1E1x1111111252@22/4>4L44455K555555555V6666666666667 77"72777G7L7W7b7g7r77777777777778888=8G8V8[8f8v888888888888899919;9E999999999999:-:6:b:z:::::::::::::::;;; ;>;J;k;;;;;#<5<:&>=>K>o>>>>>?B?P????L11111111Q2c2222222%3.3Z3r3w33333334&4/4455515F5Y555555566J6666666677G7g77777777888&8-848;8B8I8P88A9O9l999999B:K:n::::::::::::::;;;';1;;;I;T;X;v;;;;;;;;;;;;;;<<%>>$>0>t>>>>>?$?B?N???????,010f00000 1111112 22#2+2Q2l2v22222222223!3+353W3a3o3u333333333"4@4R4`4k444444 55=5G5[5e5s5~555555555555<6Z6h666666666677$7.747C7J7Q7W7`7g7r777777777777?8N889999n:}:::::: ;;;#;3;8;H;M;];b;m;;;;;;<2<<>=Q=00040L0d0|000000 1$1<1T1l1111111111111111111111111222 22222 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2x2|22222222222222222222222222333 33333 3$3(3,3034383<3@3D3H3L3P3T3X3\3`3d3h3l3p3t3x3|333333333 4$4<4T4l44444445,5D5\5t5555556 66666 6$6(6,6064686<6@6D6H6L6P6T6X6\6`6d6h6l6p6t6x6|66666666666666666666666666666666777 77777 7$7(7,7074787<7@7D7H7L7P7T7X7\7`7d7h7l7p7t7x7|777777777777777777777888 88888 8$8(8,8084888<8@8D8H8L8P8T8X8\8`8d8h8l8p8t8x8|88888889,9D9\9t999999::4:L:d:|:::::: ;$;<;T;h;l;;;;;;;;;;;;;;;;;;;;;;;;;<<< <<<<< <$<(<,<0<4<8<<<@>> >>>>> >$>(>,>0>4>8><>@>D>H>L>P>T>X>\>`>d>>>>>>?0?D?X?\?`?d?h?l?p?t?x?|????????????????????????P(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0t0x0|00000000000000000000000000011111111111111111111111111111111222 22222 2$2(2,2024282<2@2D2H2L2P2T2X2\2`2d2h2l2p2t2x2|222222222222222222222222222222222333 33333 3$3(3,3034383<3@3D3X3\3`3d3h3l3p3t3x3|33333333333 4$4<4X4\4`4d4h4l4p4t4x4|44444444444444444444444444444444455555 5$5(5,5054585<5@5D5H5L5P5T5X5\5`5d5h5l5p5t5x5|55555555555555666 66666 6$6H6L6P6T6X6\6`6d666666666666666P7T7l77777778,8D8\8t8888889949L9d9|999999 :$:<:T:l:::::::;,;H;L;P;T;X;\;`;d;h;l;p;t;x;|;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<< <<<<< <$<(<,<0<4<8<<<@d000000t7x77777777788@8D8\8t8888888889 9D9H9\9`9d9p99999999999: :D:H:\:`:d:h:l:x::::::::::;;; ;4;8;L;P;T;X;\;h;;;;;;;;;;;;<<,<0>>4>8>L>P>T>l>p>>>>>>>>>>> ??$?(?,?8?\?`?t?x?|??????????0000(0L0P0d0h0l0x0000000000 11$1(1,101D1H1\1`1d1p1111111111122 222 2D2H2\2`2d2p222222222233334383L3P3T3`33333333333334 4<4D4L4T4\4h444444444444445 55 5<5H5d5p555555566,686T6`6|6666666677,747@7\7h777777778$808L8X8t8888888999(9D9P9X999999999:0:<:D:P:l:x::::::::;;$;,;4;@;\;h;;;;;;;;; <<4<@<\$>,>8>T>\>h>>>>>>>>??,?4?>>>??? ????? ?$?(?,?0?4?8?>>> >(>0>8>@>H>P>X>`>h>p>x>>>>>>>>>>>>>>>>>???? ?(?0?8?@?H?P?X?`?0(111111111112222